ABRAXAS2 Antibody - middle region : FITC

ABRAXAS2 Antibody - middle region : FITC
Artikelnummer
AVIARP55403_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BRISC complex subunit Abraxas 2

Protein Size: 415

Purification: Affinity Purified

Subunit: Abro1
Mehr Informationen
Artikelnummer AVIARP55403_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55403_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23172
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×