ACAD8 Antibody - N-terminal region : FITC

ACAD8 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55038_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ACAD8

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: isobutyryl-CoA dehydrogenase, mitochondrial

Protein Size: 357

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55038_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55038_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27034
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×