ACBD3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD3

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi resident protein GCP60

Protein Size: 528

Purification: Affinity Purified

• Artikelnummer: AVIARP57649_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57649_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64746
• Wirt: Rabbit