ACD Antibody - middle region : Biotin

ACD Antibody - middle region : Biotin
Artikelnummer
AVIARP58253_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other comp

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACD

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adrenocortical dysplasia protein homolog

Protein Size: 544

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58253_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58253_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 65057
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×