ACOT11 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11

Molecular Weight: 65

Peptide Sequence: Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-coenzyme A thioesterase 11

Protein Size: 594

Purification: Affinity Purified

• Artikelnummer: AVIARP55280_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55280_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26027
• Wirt: Rabbit