Anti-ADAMTS5

ADAM metallopeptidase with thrombospondin type 1 motif, 5, Polyclonal, IgG, Rabbit

GeneName: ADAMTS5

Enhanced Validation: No

Concentration: 0.05

Sequence: KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC

Interspecies Mouse/Rat: ENSMUSG00000022894: 90%, ENSRNOG00000057794: 88%

Entrez Gene ID: 11096

UniProt ID: Q9UNA0

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000154736

• Artikelnummer: ATLHPA030906-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA030906-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 11096
• Wirt: Rabbit