ADAMDEC1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADAM DEC1

Protein Size: 470

Purification: Affinity Purified

• Artikelnummer: AVIARP55070_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55070_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27299
• Wirt: Rabbit