AGTPBP1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGTPBP1

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytosolic carboxypeptidase 1

Protein Size: 1186

Purification: Affinity Purified

• Artikelnummer: AVIARP55205_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55205_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23287
• Wirt: Rabbit