AKR7A3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKR7A3

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aflatoxin B1 aldehyde reductase member 3

Protein Size: 331

Purification: Affinity Purified

• Artikelnummer: AVIARP54824_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54824_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22977
• Wirt: Rabbit