ALKBH3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1519 AB042029.1 2-1520

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALKBH3

Key Reference: Sundheim,O., (2006) EMBO J. 25 (14), 3389-3397

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3

Protein Size: 286

Purification: Affinity Purified

• Artikelnummer: AVIARP55429_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55429_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 221120
• Wirt: Rabbit