English
ALLC Antibody - N-terminal region : Biotin
ALLC Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57250_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
Molecular Weight: 43kDa
Peptide Sequence: Synthetic peptide located within the following region: ERGTRTGAAATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Allantoicase, isoform CRA_a EMBL EAX01050.1
Protein Size: 391
Purification: Affinity Purified
Description of Target: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
Molecular Weight: 43kDa
Peptide Sequence: Synthetic peptide located within the following region: ERGTRTGAAATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Allantoicase, isoform CRA_a EMBL EAX01050.1
Protein Size: 391
Purification: Affinity Purified
| Artikelnummer | AVIARP57250_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57250_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 55821 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
