ALLC Antibody - N-terminal region : HRP

ALLC Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57249_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Allantoicase, isoform CRA_a EMBL EAX01050.1

Protein Size: 391

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57249_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57249_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55821
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×