Alpha Synuclein Monomers

Rat Recombinant Alpha Synuclein Protein Monomers
Artikelnummer
STRSPR-481C
Verpackungseinheit
100 µg x2
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Alpha Synuclein.

Nature: Recombinant.

Swiss-Prot: P37377.

Expression System: E. coli.

Protein Length: Full Length.

Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA.

Purification: Ion-exchange Purified.

Purity: >95%.

Storage Buffer: PBS pH 7.4.

Protein Size: 14.515 kDa.

Conjugate: No Tag.

Cellular Localization: Cytoplasm, Membrane, Nucleus.

Scientific Background: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.

References: 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013).2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–20478. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-481C
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-481C
Green Labware Nein
Verpackungseinheit 100 µg x2
Mengeneinheit PAK
Reaktivität Rat (Rattus)
Methode Western Blotting, In Vivo Assay, SDS-PAGE
Human Gene ID 29219
Produktinformation (PDF)
×
MSDS (PDF) Download