Ambp Antibody - C-terminal region : Biotin

Ambp Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59162_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.


Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein AMBP

Protein Size: 349

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59162_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59162_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25377
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×