AMD1 Antibody - N-terminal region : Biotin

AMD1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54480_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMD1

Key Reference: Guidotti,A., (2007) Neuroreport 18 (1), 57-60

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S-adenosylmethionine decarboxylase proenzyme

Protein Size: 186

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54480_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54480_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 262
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×