AMELY Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amelogenin, Y isoform

Protein Size: 192

Purification: Affinity Purified

• Artikelnummer: AVIARP54565_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54565_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 266
• Wirt: Rabbit