AMIGO3 Antibody - N-terminal region : HRP

AMIGO3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55919_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Amphoterin-induced protein 3

Protein Size: 504

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55919_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55919_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 386724
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×