ANKRD47 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD47

Key Reference: Zhu,Y., (2008) Biochim. Biophys. Acta 1780 (2), 128-133

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KN motif and ankyrin repeat domain-containing protein 3

Protein Size: 821

Purification: Affinity Purified

• Artikelnummer: AVIARP55872_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55872_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 256949
• Wirt: Rabbit