Anti-ADAMTS13

ADAM metallopeptidase with thrombospondin type 1 motif 13, Polyclonal, IgG, Rabbit

GeneName: ADAMTS13

Enhanced Validation: No

Concentration: 0.1

Sequence: RYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQV

Interspecies Mouse/Rat: ENSMUSG00000014852: 71%, ENSRNOG00000005780: 64%

Entrez Gene ID: 11093

UniProt ID: Q76LX8

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000160323

• Artikelnummer: ATLHPA052077-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA052077-100
• Green Labware: Nein
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 11093
• Wirt: Rabbit