Anti-ADAMTS2

ADAM metallopeptidase with thrombospondin type 1 motif 2, Polyclonal, IgG, Rabbit

GeneName: ADAMTS2

Enhanced Validation: No

Concentration: 0.05

Sequence: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV

Interspecies Mouse/Rat: ENSRNOG00000061484: 83%, ENSMUSG00000036545: 79%

Entrez Gene ID: 9509

UniProt ID: O95450

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000087116

• Artikelnummer: ATLHPA028363-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA028363-100
• Green Labware: Nein
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 9509
• Wirt: Rabbit