Anti-CFAP53

cilia and flagella associated protein 53, Polyclonal, IgG, Rabbit

GeneName: CFAP53

Enhanced Validation: Yes

Concentration: 0.9

Sequence: QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD

Interspecies Mouse/Rat: ENSRNOG00000014585: 75%, ENSMUSG00000035394: 75%

Entrez Gene ID: 220136

UniProt ID: Q96M91

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000172361

• Artikelnummer: ATLHPA066142-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA066142-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 220136
• Wirt: Rabbit