Anti-ECSCR

endothelial cell surface expressed chemotaxis and apoptosis regulator, Polyclonal, IgG, Rabbit

GeneName: ECSCR

Enhanced Validation: No

Concentration: 0.5

Sequence: SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT

Interspecies Mouse/Rat: ENSMUSG00000090588: 40%, ENSRNOG00000005564: 37%

Entrez Gene ID: 641700

UniProt ID: Q19T08

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000249751

• Artikelnummer: ATLHPA063337-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA063337-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 641700
• Wirt: Rabbit