Anti-FAM133B

family with sequence similarity 133, member B, Polyclonal, IgG, Rabbit

GeneName: FAM133B

Enhanced Validation: No

Concentration: 0.05

Sequence: AMARSRGPIQSSGPTIQDYLNRPRPTWEEV

Interspecies Mouse/Rat: ENSMUSG00000058503: 100%, ENSRNOG00000009163: 100%

Entrez Gene ID: 257415

UniProt ID: Q5BKY9

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000234545

• Artikelnummer: ATLHPA069513-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA069513-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 257415
• Wirt: Rabbit