Anti-FEZ1

fasciculation and elongation protein zeta 1, Polyclonal, IgG, Rabbit

GeneName: FEZ1

Enhanced Validation: No

Concentration: 0.1

Sequence: EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE

Interspecies Mouse/Rat: ENSRNOG00000006075: 96%, ENSMUSG00000032118: 98%

Entrez Gene ID: 9638

UniProt ID: Q99689

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000149557

• Artikelnummer: ATLHPA076844-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA076844-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 9638
• Wirt: Rabbit