Anti-MARCO

macrophage receptor with collagenous structure, Polyclonal, IgG, Rabbit

GeneName: MARCO

Enhanced Validation: Yes

Concentration: 0.27

Sequence: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV

Interspecies Mouse/Rat: ENSRNOG00000049303: 57%, ENSMUSG00000026390: 52%

Entrez Gene ID: 8685

UniProt ID: Q9UEW3

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000019169

• Artikelnummer: ATLHPA063793-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA063793-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 8685
• Wirt: Rabbit