Anti-OPG (AbAb01OPG)

Anti-OPG [AbAb01OPG], Monoclonal, IgG, kappa, Host: Rabbit

CloneID: AbAb01OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).

Buffer Composition: PBS with 0.02% Proclin 300.

Concentration: 1 mg/ml

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Uniprot Accession No.: O00300

• Artikelnummer: ABAAb04113-23.0
• Hersteller: Absolute Antibody
• Hersteller Artikelnummer: Ab04113-23.0
• Green Labware: Nein
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: ELISA
• Isotyp: IgG
• Wirt: Rabbit