Anti-PAQR8

progestin and adipoQ receptor family member VIII, Polyclonal, IgG, Rabbit

GeneName: PAQR8

Enhanced Validation: No

Concentration: 0.8

Sequence: MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY

Interspecies Mouse/Rat: ENSMUSG00000025931: 96%, ENSRNOG00000012830: 98%

Entrez Gene ID: 85315

UniProt ID: Q8TEZ7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000170915

• Artikelnummer: ATLHPA064625-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA064625-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 85315
• Wirt: Rabbit