Anti-PCDH11X

protocadherin 11 X-linked, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: PCDH11X

Enhanced Validation: No

Concentration: 0.1

Sequence: PVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQRRVTF

Interspecies Mouse/Rat: ENSMUSG00000034755: 81%, ENSRNOG00000004118: 37%

Entrez Gene ID: 27328

UniProt ID: Q9BZA7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000102290

• Artikelnummer: ATLHPA077495-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA077495-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 27328
• Wirt: Rabbit