Anti-ZBTB6

zinc finger and BTB domain containing 6, Polyclonal, IgG, Rabbit

GeneName: ZBTB6

Enhanced Validation: No

Concentration: 0.05

Sequence: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC

Interspecies Mouse/Rat: ENSRNOG00000009340: 86%, ENSMUSG00000066798: 88%

Entrez Gene ID: 10773

UniProt ID: Q15916

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000186130

• Artikelnummer: ATLHPA076894-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA076894-25
• Green Labware: Nein
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 10773
• Wirt: Rabbit