Anti-ZBTB9

zinc finger and BTB domain containing 9, Polyclonal, IgG, Rabbit

GeneName: ZBTB9

Enhanced Validation: No

Concentration: 0.3

Sequence: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT

Interspecies Mouse/Rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%

Entrez Gene ID: 221504

UniProt ID: Q96C00

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000213588

• Artikelnummer: ATLHPA058171-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA058171-100
• Green Labware: Nein
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 221504
• Wirt: Rabbit