APBB1IP Antibody - N-terminal region : Biotin

APBB1IP Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57312_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APBB1IP

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein

Protein Size: 666

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57312_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57312_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54518
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×