English
Apbb1ip Antibody - N-terminal region : HRP
Apbb1ip Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57311_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The function of Apbb1ip remains unknown.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Molecular Weight: 74kDa
Peptide Sequence: Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Size: 664
Purification: Affinity Purified
Description of Target: The function of Apbb1ip remains unknown.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Molecular Weight: 74kDa
Peptide Sequence: Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Size: 664
Purification: Affinity Purified
| Artikelnummer | AVIARP57311_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57311_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 307171 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
