APBB2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APBB2

Key Reference: Hong,Q., (er) BMC Mol. Biol. 8, 50 (2007)

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 2

Protein Size: 736

Purification: Affinity Purified

• Artikelnummer: AVIARP55624_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55624_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 323
• Wirt: Rabbit