APIP Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APIP

Key Reference: Cho,D.H., (2004) J. Biol. Chem. 279 (38), 39942-39950

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 242

Purification: Affinity Purified

• Artikelnummer: AVIARP56789_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56789_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51074
• Wirt: Rabbit