English
APOBEC4 Antibody - N-terminal region : Biotin
APOBEC4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55975_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC4
Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
Molecular Weight: 41kDa
Peptide Sequence: Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Putative C->U-editing enzyme APOBEC-4
Protein Size: 367
Purification: Affinity Purified
Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC4
Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
Molecular Weight: 41kDa
Peptide Sequence: Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Putative C->U-editing enzyme APOBEC-4
Protein Size: 367
Purification: Affinity Purified
| Artikelnummer | AVIARP55975_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55975_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 403314 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
