APOL5 Antibody - C-terminal region : Biotin

APOL5 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58858_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APOL5

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAPARKGRQAPGRHRQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein L5

Protein Size: 433

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58858_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58858_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 80831
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×