App Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: App functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. It is involved in cell mobility and transcription regulation through protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human App

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 protein

Protein Size: 751

Purification: Affinity Purified

• Artikelnummer: AVIARP58851_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58851_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11820
• Wirt: Rabbit