App Antibody - C-terminal region : FITC

App Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58851_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: App functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. It is involved in cell mobility and transcription regulation through protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human App

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 protein

Protein Size: 751

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58851_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58851_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11820
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×