ARAF Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARAF

Key Reference: Razzaque,M.A., (2007) Nat. Genet. 39 (8), 1013-1017

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase A-Raf

Protein Size: 606

Purification: Affinity Purified

• Artikelnummer: AVIARP54592_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54592_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 369
• Wirt: Rabbit