ARCN1 Antibody - middle region : HRP

ARCN1 Antibody - middle region : HRP
Artikelnummer
AVIARP54594_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.This gene maps in a region, which include the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. It is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARCN1

Key Reference: Belanger,B.F., Trends Cell Biol. 16 (10), E1-E4 (2006)

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coatomer subunit delta

Protein Size: 511

Purification: Affinity Purified

Subunit: delta
Mehr Informationen
Artikelnummer AVIARP54594_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54594_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 372
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×