Arf4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Arf4 is an GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. It is Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor 4

Protein Size: 180

Purification: Affinity Purified

Specificity#: This antibody is predicted to react to human ARF1,3,4,5 (100% homology) and 6 (93%).

• Artikelnummer: AVIARP56032_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56032_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11843
• Wirt: Rabbit