ARFIP1 Antibody - C-terminal region : HRP

ARFIP1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54460_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARFIP1 is a putative target protein of ADP-ribosylation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARFIP1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arfaptin-1

Protein Size: 373

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54460_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54460_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27236
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×