ARHGAP30 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP30

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 30

Protein Size: 890

Purification: Affinity Purified

• Artikelnummer: AVIARP54462_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54462_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 257106
• Wirt: Rabbit