ARHGAP45 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human HMHA1

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: rho GTPase-activating protein 45

Protein Size: 771

Purification: Affinity Purified

• Artikelnummer: AVIARP54876_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54876_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23526
• Wirt: Rabbit