ARMC3 Antibody - middle region : FITC

ARMC3 Antibody - middle region : FITC
Artikelnummer
AVIARP55626_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARMC3

Key Reference: Li,X., (2006) Genetika 42 (7), 999-1003

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 3

Protein Size: 872

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55626_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55626_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219681
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×