Arsg Antibody - middle region : Biotin

Arsg Antibody - middle region : Biotin
Artikelnummer
AVIARP55121_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Arsg displays arylsulfatase activity with pseudosubstrates at acidic pH, such as p-nitrocatechol sulfate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Arsg

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arylsulfatase G

Protein Size: 526

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55121_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55121_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 303631
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×