ASF1A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASF1A

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone chaperone ASF1A

Protein Size: 204

Purification: Affinity Purified

• Artikelnummer: AVIARP58260_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58260_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25842
• Wirt: Rabbit