English
ASPA Antibody - N-terminal region : FITC
ASPA Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56072_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The specific function of SASP is not yet known.This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASPA
Key Reference: Le (2008) Biochemistry 47 (11), 3484-3492
Molecular Weight: 36kDa
Peptide Sequence: Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Aspartoacylase
Protein Size: 313
Purification: Affinity Purified
Description of Target: The specific function of SASP is not yet known.This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASPA
Key Reference: Le (2008) Biochemistry 47 (11), 3484-3492
Molecular Weight: 36kDa
Peptide Sequence: Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Aspartoacylase
Protein Size: 313
Purification: Affinity Purified
| Artikelnummer | AVIARP56072_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56072_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 443 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
