English
Ataxin 1 Antibody, Clone N76/8: APC
Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
Artikelnummer
STRSMC-455D-APC
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Target: Ataxin 1
Conjugate: APC
Product Type: Monoclonal
Clone Number: N76/8 (Formerly sold as S76-8)
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Swiss-Prot: P54254
Purification: Protein G Purified
Storage Buffer: PBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Concentration: 1 mg/ml
Specificity: Detects ~85kDa.
Cellular Localization: Cytoplasm,Nucleus
Scientific Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Conjugate: APC
Product Type: Monoclonal
Clone Number: N76/8 (Formerly sold as S76-8)
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Swiss-Prot: P54254
Purification: Protein G Purified
Storage Buffer: PBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Concentration: 1 mg/ml
Specificity: Detects ~85kDa.
Cellular Localization: Cytoplasm,Nucleus
Scientific Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
| Artikelnummer | STRSMC-455D-APC |
|---|---|
| Hersteller | Stressmarq Biosciences |
| Hersteller Artikelnummer | SMC-455D-APC |
| Green Labware | Nein |
| Verpackungseinheit | 100 µg |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus) |
| Klonalität | Monoclonal |
| Methode | Immunofluorescence, Immunoprecipitation, Western Blotting, Immunohistochemistry, Immunocytochemistry |
| Isotyp | IgG2b |
| Human Gene ID | 20238 |
| Wirt | Mouse |
| Produktinformation (PDF) | Download |
| MSDS (PDF) | Download |
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
