English
ATG4A Antibody - middle region : FITC
ATG4A Antibody - middle region : FITC
Artikelnummer
AVIARP58927_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4A
Molecular Weight: 28kDa
Peptide Sequence: Synthetic peptide located within the following region: AVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSDELIFLD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cysteine protease ATG4A
Protein Size: 259
Purification: Affinity Purified
Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4A
Molecular Weight: 28kDa
Peptide Sequence: Synthetic peptide located within the following region: AVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSDELIFLD
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cysteine protease ATG4A
Protein Size: 259
Purification: Affinity Purified
| Artikelnummer | AVIARP58927_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58927_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 115201 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
