ATP6V1A Antibody - N-terminal region : Biotin

ATP6V1A Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56324_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1A

Key Reference: Lu,M., (2007) J. Biol. Chem. 282 (34), 24495-24503

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase catalytic subunit A

Protein Size: 617

Purification: Affinity Purified

Subunit: A
Mehr Informationen
Artikelnummer AVIARP56324_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56324_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 523
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×